VIP (human, mouse, rat) . AcOH [RLF-100]
As low as
$210.00
In stock
| Product code: | 15-4010 |
|---|
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
| Amount | 5 mg |
|---|---|
| Purification | >=98% (HPLC) |
| Content | VIP is supplied as a white to off-white lyophilized powder. |
| Storage condition | Store at +4°C for short term storage. Stable for at least 2 years after receipt when stored at -20°C. |
| AA sequence | H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 |
| Alternative Name | Aviptadil, HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, Vasoactive Intestinal Peptide, Vasoactive Intestinal Octacosapeptide. |
| Alternative Name | Aviptadil, HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, Vasoactive Intestinal Peptide, Vasoactive Intestinal Octacosapeptide. |
|---|
Molecular Formula: C147H238N44O42S . C2H4O2
Molecular Weight: 3325.8 . 60.0
Vasoactive intestinal peptide (VIP) is a 28 aa peptide that belongs to secretin-glucagon-CRF superfamily, the ligand of class II G protein-coupled receptors subclass B1. VIP binds to the receptors VPAC1, VPAC2 and with less sensitivity to PAC1, which trigger a G-α-mediated signaling cascade, eventually activating adenyl cyclase leading to increases in cAMP and PKA. The PKA then activates other intracellular signaling pathways like the phosphorylation of CREB and other transcriptional factors. The VIP receptors are widely expressed in brain, liver, lung, pancreas, skeletal muscle, heart, kidney, adipose tissue, testis and stomach and also abundantly in immune cells. Although first identified in the intestinal tract, VIP is now known to be produced throughout the body, but primarily concentrated in the lungs, bound to the alveolar type II cell type, which is critical for the transmission of oxygen to the body.
The widespread distributio
Application Note:
A stock solution may be made by soluble in water or aqueous solution (1% AcOH) (1mg/ml).
Write Your Own Review